PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0241s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 374aa    MW: 41892.8 Da    PI: 8.328
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0241s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70225.92.9e-084277540
                  DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvk 40
                            + +C +CGn a+  C ++ C+ CC      C+ hv 
  SapurV1A.0241s0070.1.p 42 KPKCIQCGNVARSRCPYQSCKSCCSRAQNPCHIHVL 77
                            568*********************99999*****94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.0E-54479IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MAASSPVMSN NSSETGQTSI STAAGGTTSF SAPPKTLRGL NKPKCIQCGN VARSRCPYQS  60
CKSCCSRAQN PCHIHVLKAN ATFPDKTPAS SAPLFEQQVN EAPPPVSSHR AASLRQLSSN  120
FSQFNNLHSP LRSRKPLTRK EAAAINEWRF SKLKEFRDRN IEVENEAFDR YMHNISLLEE  180
VFSLKSFLEG STEGESLSSN HDHACAKDDT EEKMVSEQKL KLRSNLSRSE NDRKRLQQVV  240
DVGLKKLQKL ELNNGSVNSR SELDKRPETA KSLRAERASA LSDLMDKLNK ARNEEDLKSC  300
LETRAQLYSQ RDRSRTETED SEVLREQTAK KDVAPQKELD YFSQKLFRAV EIDHEALTSI  360
DAHFSSLEKI EDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385592.10.0hypothetical protein POPTR_0003s08400g
TrEMBLU5GMG10.0U5GMG1_POPTR; Uncharacterized protein
STRINGPOPTR_0003s08400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF76901618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.11e-107